PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59775.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 194aa    MW: 22287.8 Da    PI: 9.8362
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59775.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.32.6e-30959151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                krien + rqvtfskRrng+lKKA+ELSvLCdae+a+iifs++gklye++s
  EPS59775.1  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEIALIIFSPRGKLYEFAS 59
                79***********************************************86 PP

2K-box72.41.3e-24891771199
       K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                 e++  +l+ e+a + k+ie+L+ ++R+llGe+L s +++eLqq+e+qLe+sl+ iR +K +l+++qi +l++k k+l  en +L++k+e
  EPS59775.1  89 EQNLLHLEVEAASMMKKIEQLEASKRKLLGEGLASSTIEELQQIEKQLERSLTAIRGRKIQLYKQQIVKLKEKGKALAAENAMLSEKVE 177
                 677889999*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.861161IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-41160IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.19E-43374No hitNo description
SuperFamilySSF554553.27E-33374IPR002100Transcription factor, MADS-box
PfamPF003191.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.89392182IPR002487Transcription factor, K-box
PfamPF014863.5E-2395176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEIALIIFSP RGKLYEFASS  60
SMPETIERYQ KHTKEIQPTY PNPNPNPIEQ NLLHLEVEAA SMMKKIEQLE ASKRKLLGEG  120
LASSTIEELQ QIEKQLERSL TAIRGRKIQL YKQQIVKLKE KGKALAAENA MLSEKVELDH  180
IYTYNHITIN DDVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-20389285Myocyte-specific enhancer factor 2A
3kov_B2e-20389285Myocyte-specific enhancer factor 2A
3kov_I2e-20389285Myocyte-specific enhancer factor 2A
3kov_J2e-20389285Myocyte-specific enhancer factor 2A
3p57_A2e-20389285Myocyte-specific enhancer factor 2A
3p57_B2e-20389285Myocyte-specific enhancer factor 2A
3p57_C2e-20389285Myocyte-specific enhancer factor 2A
3p57_D2e-20389285Myocyte-specific enhancer factor 2A
3p57_I2e-20389285Myocyte-specific enhancer factor 2A
3p57_J2e-20389285Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843634.15e-91PREDICTED: MADS-box protein SOC1
RefseqXP_012843635.15e-91PREDICTED: MADS-box protein SOC1
SwissprotO646452e-85SOC1_ARATH; MADS-box protein SOC1
TrEMBLS8BYX01e-141S8BYX0_9LAMI; Uncharacterized protein
STRINGGLYMA07G08831.17e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-68AGAMOUS-like 20
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]